HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "O43460",
"id": "O43460_HUMAN",
"source_organism": {
"taxId": "9606",
"scientificName": "Homo sapiens",
"fullName": "Homo sapiens (Human)"
},
"name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN",
"description": null,
"length": 403,
"sequence": "RTAIIKEIVSRNKRRYQEDGFDLDLTYIYLNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIHNLCAERHYDTAKSNYRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGIMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLVKNHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVCQLKVKIYSSNSGPTRWEDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNVKVKLYFTKTVEEPSNPEASSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHTQITKV",
"proteome": null,
"gene": "PTH2",
"go_terms": [
{
"identifier": "GO:0016791",
"name": "phosphatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016311",
"name": "dephosphorylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016314",
"name": "phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051717",
"name": "inositol-1,3,4,5-tetrakisphosphate 3-phosphatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051800",
"name": "phosphatidylinositol-3,4-bisphosphate 3-phosphatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008285",
"name": "negative regulation of cell population proliferation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0046856",
"name": "phosphatidylinositol dephosphorylation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6c0458621e8ae2ef30ee0993d4f8b118aa51d371",
"counters": {
"domain_architectures": 2806,
"entries": 26,
"isoforms": 0,
"proteomes": 0,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"profile": 3,
"ssf": 2,
"smart": 3,
"cdd": 1,
"pfam": 2,
"pirsf": 1,
"panther": 1,
"prosite": 1,
"interpro": 10
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 2806
}
}
}