General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "O27122",
        "id": "RPO5_METTH",
        "source_organism": {
            "taxId": "187420",
            "scientificName": "Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)",
            "fullName": "Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)"
        },
        "name": "DNA-directed RNA polymerase subunit Rpo5",
        "description": [
            "DNA-dependent RNA polymerase (RNAP) catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates"
        ],
        "length": 77,
        "sequence": "MKREILKHQLVPEHVILNESEAKRVLKELDAHPEQLPKIKTTDPVAKAIGAKRGDIVKIIRKSPTAEEFVTYRLVQD",
        "proteome": "UP000005223",
        "gene": "rpo5",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003899",
                "name": "DNA-directed RNA polymerase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006351",
                "name": "DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "93654189c56d71caddffde6bd9232c2bd508ca2a",
        "counters": {
            "domain_architectures": 1730,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 1,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "ncbifam": 1,
                "hamap": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1730
        }
    }
}