GET /api/protein/UniProt/O22510/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "O22510",
        "id": "O22510_ORYSA",
        "source_organism": {
            "taxId": "4530",
            "scientificName": "Oryza sativa",
            "fullName": "Oryza sativa (Rice)"
        },
        "name": "Peroxidase",
        "description": [
            "Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress"
        ],
        "length": 353,
        "sequence": "MASKLGMVVLLISGFFAARCAAVVTTGEPVVAGLSWGFYDTSCPSVEGIVRWHVTEALRRDIGIAAGLVRIFFHDCFPQGCDASVLLTGSQSELGEIPNQTLRPSALKLIEDIRAAVQSACGAKVSCADITTLATRDAIVASGGPYLDVPLGRRDGLAPASSDKVGLLPAPFFDVPTLIQAFKDRNLDKTDLVALSGAHTIGLGHCGSFNDRFDGSKPIMDPVLVKKLQAKCAKDVPVNSVTQELDVRTPNAFDNKYYFDLIAKQGIFKSDQGLIEDAQTNRTAVRFALNQAAFFDQFARSMVKMSQMDVLTGNAGEIRNNCAAPNRRSSELLQRCRRRPRLRRGRLINLWSN",
        "proteome": null,
        "gene": "OsCPX1",
        "go_terms": [
            {
                "identifier": "GO:0004601",
                "name": "peroxidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0042744",
                "name": "hydrogen peroxide catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0020037",
                "name": "heme binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006979",
                "name": "response to oxidative stress",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "14f0affbad7d6f2240b4fb0cbb503bfe9b0e92c5",
        "counters": {
            "domain_architectures": 59418,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "ssf": 1,
                "profile": 1,
                "cathgene3d": 2,
                "pfam": 1,
                "panther": 1,
                "prints": 2,
                "prosite": 2,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 59418
        }
    }
}