HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "O22510",
"id": "O22510_ORYSA",
"source_organism": {
"taxId": "4530",
"scientificName": "Oryza sativa",
"fullName": "Oryza sativa (Rice)"
},
"name": "Peroxidase",
"description": [
"Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress"
],
"length": 353,
"sequence": "MASKLGMVVLLISGFFAARCAAVVTTGEPVVAGLSWGFYDTSCPSVEGIVRWHVTEALRRDIGIAAGLVRIFFHDCFPQGCDASVLLTGSQSELGEIPNQTLRPSALKLIEDIRAAVQSACGAKVSCADITTLATRDAIVASGGPYLDVPLGRRDGLAPASSDKVGLLPAPFFDVPTLIQAFKDRNLDKTDLVALSGAHTIGLGHCGSFNDRFDGSKPIMDPVLVKKLQAKCAKDVPVNSVTQELDVRTPNAFDNKYYFDLIAKQGIFKSDQGLIEDAQTNRTAVRFALNQAAFFDQFARSMVKMSQMDVLTGNAGEIRNNCAAPNRRSSELLQRCRRRPRLRRGRLINLWSN",
"proteome": null,
"gene": "OsCPX1",
"go_terms": [
{
"identifier": "GO:0004601",
"name": "peroxidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0042744",
"name": "hydrogen peroxide catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0020037",
"name": "heme binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006979",
"name": "response to oxidative stress",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "14f0affbad7d6f2240b4fb0cbb503bfe9b0e92c5",
"counters": {
"domain_architectures": 59418,
"entries": 17,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"ssf": 1,
"profile": 1,
"cathgene3d": 2,
"pfam": 1,
"panther": 1,
"prints": 2,
"prosite": 2,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 59418
}
}
}