GET /api/protein/UniProt/O13276/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "O13276",
        "id": "LDHA_SPHAG",
        "source_organism": {
            "taxId": "55125",
            "scientificName": "Sphyraena argentea",
            "fullName": "Sphyraena argentea (Pacific barracuda)"
        },
        "name": "L-lactate dehydrogenase A chain",
        "description": [
            "Interconverts simultaneously and stereospecifically pyruvate and lactate with concomitant interconversion of NADH and NAD(+)"
        ],
        "length": 332,
        "sequence": "MSTKEKLIGHVMKEEPIGSRNKVTVVGVGMVGMASAVSILLKDLCDELALVDVMEDKLKGEAMDLQHGSLFLKTHKIVADKDYSVTANSRVVVVTAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPNCILMVVSNPVDILTYVAWKLSGFPRHRVIGSGTNLDSARFRHIMGEKLHLHPSSCHGWIVGEHGDSSVPVWSGVNVAGVSLQTLNPKMGAEGDSENWKAVHKMVVDGAYEVIKLKGYTSWAIGMSVADLVESIVKNCTKCTQCPRWSRGMHGVKDEVFLSVPCVLGNSGLTDVIHMTLKPEEEKQLVKSAETLWGVQKELTL",
        "proteome": null,
        "gene": "ldha",
        "go_terms": [
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016616",
                "name": "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004459",
                "name": "L-lactate dehydrogenase (NAD+) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0019752",
                "name": "carboxylic acid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "efa9ddffcabca3280ae0d7a3462c2f8e6d373a42",
        "counters": {
            "domain_architectures": 58034,
            "entries": 20,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 2,
                "pfam": 2,
                "cdd": 1,
                "panther": 1,
                "hamap": 1,
                "pirsf": 1,
                "ncbifam": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 7
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 58034
        }
    }
}