GET /api/protein/UniProt/N9MY13/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "N9MY13",
        "id": "N9MY13_9GAMM",
        "source_organism": {
            "taxId": "1776740",
            "scientificName": "Acinetobacter modestus",
            "fullName": "Acinetobacter modestus"
        },
        "name": "Large ribosomal subunit protein uL5",
        "description": [
            "This is 1 of the proteins that bind and probably mediate the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs"
        ],
        "length": 178,
        "sequence": "MARLKARYNDELKAKLQEELGVKNVMDIPRITKITLNMGVGAAATDKKLLDGAVADMQLIAGQKPVVTLARKSIAGFKIRDGWPIGCKVTLRGDQMYEFLDRLISIAIPRIRDFRGFSSKSFDGRGNYSMGLKEQIVFPEIDFDKIDRIRGLDITITTTARSDDEGRALMRAFGFPFK",
        "proteome": "UP000013190",
        "gene": "rplE",
        "go_terms": [
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005840",
                "name": "ribosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e2c17c1ca7c2a8fca525acf376dac4e5e468b71f",
        "counters": {
            "domain_architectures": 32787,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 2,
                "hamap": 1,
                "ncbifam": 1,
                "pirsf": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 32787
        }
    }
}