GET /api/protein/UniProt/N8ZR99/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "N8ZR99",
"id": "N8ZR99_ACIVR",
"source_organism": {
"taxId": "1191460",
"scientificName": "Acinetobacter venetianus (strain ATCC 31012 / DSM 23050 / BCRC 14357 / CCUG 45561 / CIP 110063 / KCTC 2702 / LMG 19082 / RAG-1)",
"fullName": "Acinetobacter venetianus (strain ATCC 31012 / DSM 23050 / BCRC 14357 / CCUG 45561 / CIP 110063 / KCTC 2702 / LMG 19082 / RAG-1)"
},
"name": "Biopolymer transporter ExbD",
"description": [
"Involved in the TonB-dependent energy-dependent transport of various receptor-bound substrates"
],
"length": 139,
"sequence": "MGMNVGPKSSEDDVMLDVNMTPLIDVMLVLLIMFIITIPIPNNAININLPNGTPPPPTDQKPPEVINLRVDAQGQIFWNDQVVADRQALKALFENVAQKADQDQIKFKPDAQAEYKNIAMVMALAQQSNVTKIGIVSNN",
"proteome": "UP000018445",
"gene": "F959_02819",
"go_terms": [
{
"identifier": "GO:0022857",
"name": "transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0055085",
"name": "transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d0dc1de7b722f382c0a99228cc8872557ae5c59a",
"counters": {
"domain_architectures": 48732,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 48732
}
}
}