General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "N6Z2Z5",
        "id": "N6Z2Z5_9RHOO",
        "source_organism": {
            "taxId": "1234382",
            "scientificName": "Thauera phenylacetica B4P",
            "fullName": "Thauera phenylacetica B4P"
        },
        "name": "dITP/XTP pyrophosphatase",
        "description": [
            "Pyrophosphatase that catalyzes the hydrolysis of nucleoside triphosphates to their monophosphate derivatives, with a high preference for the non-canonical purine nucleotides XTP (xanthosine triphosphate), dITP (deoxyinosine triphosphate) and ITP. Seems to function as a house-cleaning enzyme that removes non-canonical purine nucleotides from the nucleotide pool, thus preventing their incorporation into DNA/RNA and avoiding chromosomal lesions"
        ],
        "length": 201,
        "sequence": "MSKRLVLASNNAKKAAEMQALLAPLGIEVIPQSVFGVGEAEEPHPSFVENALAKARHAAAATGLPTVADDSGLCVEALGGAPGVLSARFAGEPRSDARNNALLLEKLAHLTEPAQRRAYFYSAVVLVRHAEDPRPLIADGEWHGEILPAARGEGGFGYDPLFWLPELEQTAAELEPALKNTLSHRGAAMRHLLDRLAEHPL",
        "proteome": "UP000013047",
        "gene": "C667_04815",
        "go_terms": [
            {
                "identifier": "GO:0047429",
                "name": "nucleoside triphosphate diphosphatase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009143",
                "name": "nucleoside triphosphate catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0017111",
                "name": "ribonucleoside triphosphate phosphatase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "029a777975285995c6aff1e90978714c8929fb21",
        "counters": {
            "domain_architectures": 32111,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 32111
        }
    }
}