General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "N4XX91",
        "id": "N4XX91_COCH4",
        "source_organism": {
            "taxId": "665024",
            "scientificName": "Cochliobolus heterostrophus (strain C4 / ATCC 48331 / race T)",
            "fullName": "Cochliobolus heterostrophus (strain C4 / ATCC 48331 / race T) (Southern corn leaf blight fungus)"
        },
        "name": "SUI1 domain-containing protein",
        "description": [
            "Additional factor that functions in concert with eIF-2 and the initiator tRNA in directing the ribosome to the proper start site of translation"
        ],
        "length": 215,
        "sequence": "MASKKDMRRADLIVPYAEPEKSKDEGDMSSTLSSTLPMAAIFTRNKMIGWVAVVFAIQAWLAETAEQRKTSTTPAYFQVGMSIMSLLVPPTYTRAPTDSRMSIENLKTFDPFAEADEDTGQVKQTQQDYIHIRIQQRNGRKTLTTVQGLPKKFDQKKILKVIKKKFACNGTIVSDAEMGEVVQLQGDQRKDVQDFLTDKKEGLGLDAKTIKVHGF",
        "proteome": "UP000012338",
        "gene": "COCC4DRAFT_158175",
        "go_terms": [
            {
                "identifier": "GO:0003743",
                "name": "translation initiation factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006413",
                "name": "translational initiation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0044183",
                "name": "protein folding chaperone",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0045048",
                "name": "protein insertion into ER membrane",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005789",
                "name": "endoplasmic reticulum membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "df14f49ed5540e16e9b2f61818656c35ae13de3e",
        "counters": {
            "domain_architectures": 49,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 2,
                "cdd": 1,
                "profile": 1,
                "ncbifam": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 49
        }
    }
}