GET /api/protein/UniProt/N4TXU4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "N4TXU4",
        "id": "N4TXU4_FUSC1",
        "source_organism": {
            "taxId": "1229664",
            "scientificName": "Fusarium oxysporum f. sp. cubense (strain race 1)",
            "fullName": "Fusarium oxysporum f. sp. cubense (strain race 1) (Panama disease fungus)"
        },
        "name": "mRNA 3'-end-processing protein",
        "description": [
            "Component of the cleavage factor I (CF I) involved in pre-mRNA 3'-end processing"
        ],
        "length": 252,
        "sequence": "MPGAVESPASAILNHSATPYNFRFSPFLRQTYQVGLSPDRPICKAFQSGHCPNGTRCPERHVSDSKTSQPSGGLNSLVCKHWLRGLCKKGEHCEFLHEYNLRKMPECNFFMRNGYCSNGDECLYLHIDPQSRLPPCPHYDMGFCPLGPNCSKKHVRRKLCVFYLAGFCPDGPECKEGAHPKWSKDLEKPTLKSEEKKDEDIRIDSAQDDVDRSRDQQRDRDRDDGGRHRGGHGGHGGRGKWRGRGRYRGRGH",
        "proteome": null,
        "gene": "FOC1_g10016231",
        "go_terms": [
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cd1c27befd94e789845ff93ee440ce81dc3b587a",
        "counters": {
            "domain_architectures": 120,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "smart": 1,
                "pfam": 2,
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 120
        }
    }
}