GET /api/protein/UniProt/N4TXU4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "N4TXU4",
"id": "N4TXU4_FUSC1",
"source_organism": {
"taxId": "1229664",
"scientificName": "Fusarium oxysporum f. sp. cubense (strain race 1)",
"fullName": "Fusarium oxysporum f. sp. cubense (strain race 1) (Panama disease fungus)"
},
"name": "mRNA 3'-end-processing protein",
"description": [
"Component of the cleavage factor I (CF I) involved in pre-mRNA 3'-end processing"
],
"length": 252,
"sequence": "MPGAVESPASAILNHSATPYNFRFSPFLRQTYQVGLSPDRPICKAFQSGHCPNGTRCPERHVSDSKTSQPSGGLNSLVCKHWLRGLCKKGEHCEFLHEYNLRKMPECNFFMRNGYCSNGDECLYLHIDPQSRLPPCPHYDMGFCPLGPNCSKKHVRRKLCVFYLAGFCPDGPECKEGAHPKWSKDLEKPTLKSEEKKDEDIRIDSAQDDVDRSRDQQRDRDRDDGGRHRGGHGGHGGRGKWRGRGRYRGRGH",
"proteome": null,
"gene": "FOC1_g10016231",
"go_terms": [
{
"identifier": "GO:0046872",
"name": "metal ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "cd1c27befd94e789845ff93ee440ce81dc3b587a",
"counters": {
"domain_architectures": 120,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"smart": 1,
"pfam": 2,
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 120
}
}
}