General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "N4TVQ2",
        "id": "N4TVQ2_FUSC1",
        "source_organism": {
            "taxId": "1229664",
            "scientificName": "Fusarium oxysporum f. sp. cubense (strain race 1)",
            "fullName": "Fusarium oxysporum f. sp. cubense (strain race 1) (Panama disease fungus)"
        },
        "name": "F-actin-capping protein subunit beta",
        "description": [
            "F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments"
        ],
        "length": 282,
        "sequence": "MAVDPFDSALDLLRRLNPKQTTDHLNAIISIAPDLTEDLLSSVDQPLTVRRCKQTGRDYLLCDYNRDGDSYRSPWSNQFDPPLDEAGSGGVGAGGNEGAGEGAIPSERVRKMEVKANEAFDVYRDLYYEGGVSSVYFWNLDDGFAGVVLLKKSSPQGGNSEGVWDSIHVFEAIERGRSTHYKLTSTVILTLSTTGGNLGEMDLSGNMTRQVEQDLPVDNDDSHIANVGRLVEDMELKMRNLLQEVYFGKAKDVVGDLRSIGSLSEGARDREAQRELIGSMRR",
        "proteome": null,
        "gene": "FOC1_g10015446",
        "go_terms": [
            {
                "identifier": "GO:0051016",
                "name": "barbed-end actin filament capping",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008290",
                "name": "F-actin capping protein complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0003779",
                "name": "actin binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030036",
                "name": "actin cytoskeleton organization",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c65d17b3b2ac2131013ceafb4fadc6e00b655a1f",
        "counters": {
            "domain_architectures": 5039,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 5039
        }
    }
}