General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "N1W8N2",
        "id": "N1W8N2_9LEPT",
        "source_organism": {
            "taxId": "1218598",
            "scientificName": "Leptospira weilii serovar Ranarum str. ICFT",
            "fullName": "Leptospira weilii serovar Ranarum str. ICFT"
        },
        "name": "Diadenylate cyclase",
        "description": [
            "Catalyzes the condensation of 2 ATP molecules into cyclic di-AMP (c-di-AMP), a second messenger used to regulate differing processes in different bacteria"
        ],
        "length": 271,
        "sequence": "MFFFKNISLFPLGKNPLVIAIDLLIVSFLIYQFYTTIRRTRGIQLLLGVAVIWFLGIFASTFELELLDWIIENIRPALVFAIIVLLQPELRKITADLSKMKIFQPFLLKQMTDLEEIIEAVKIMAKNKTGSLIAIVRENSLKEIIDQSVQLDAIISKSLLLTVFKKNSALHDGAVIIEQNRIACAGAFLPMTQNLDDARMGARHRAAIGISEESDSIVIVTSEETGEISVCYDGEIIHPVKPIELKNLVNTILQKKDIGFEKNNSSEDKTG",
        "proteome": "UP000012313",
        "gene": "dacA",
        "go_terms": [
            {
                "identifier": "GO:0004016",
                "name": "adenylate cyclase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006171",
                "name": "cAMP biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2126d3d652f43dc84828eefba7a5b3a6c52f9eca",
        "counters": {
            "domain_architectures": 7364,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "profile": 1,
                "cathgene3d": 1,
                "hamap": 1,
                "panther": 1,
                "pfam": 2,
                "pirsf": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7364
        }
    }
}