GET /api/protein/UniProt/M6HH47/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "M6HH47",
        "id": "M6HH47_LEPIR",
        "source_organism": {
            "taxId": "1001601",
            "scientificName": "Leptospira interrogans serovar Zanoni str. LT2156",
            "fullName": "Leptospira interrogans serovar Zanoni str. LT2156"
        },
        "name": "Lipoyl synthase",
        "description": [
            "Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives"
        ],
        "length": 301,
        "sequence": "MNPLKKKPRTHSLQNAPEKPDWLKVKLAFPDPKNNPVAIVRNSLEEKKLNTVCESASCPNLNHCWSRKTATYMLGGDICTRRCSYCDVASGKPFPLDPEEPKRIAESSIALGLRHVVITSVNRDDLEDGGAAHFAKTVKEIRKGLPDCKIELLIPDLKVKQEALEIIFECNPDIFNHNLETVKRLFPEVAPQKRYERSLDVLKIASARGFLTKSGLILGMGETLEEVKECMQDLASVGVSLLTLGQYLQPTSTHLPVKEYVVPQVFKDLRIYGKSIGFKGVFSGPLVRSSYHADEQISWNP",
        "proteome": null,
        "gene": "lipA",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051536",
                "name": "iron-sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016992",
                "name": "lipoate synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051539",
                "name": "4 iron, 4 sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009107",
                "name": "lipoate biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1d7b556ab52b38ef5d2d40d0fa5e3282ff6cdc48",
        "counters": {
            "domain_architectures": 140037,
            "entries": 20,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "profile": 1,
                "smart": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "cdd": 1,
                "hamap": 1,
                "ncbifam": 3,
                "sfld": 3,
                "pirsf": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 140037
        }
    }
}