GET /api/protein/UniProt/M4ZRY7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "M4ZRY7",
        "id": "M4ZRY7_9FLAO",
        "source_organism": {
            "taxId": "1229512",
            "scientificName": "Blattabacterium cuenoti BPAA",
            "fullName": "Blattabacterium cuenoti BPAA"
        },
        "name": "Adenylosuccinate synthetase",
        "description": [
            "Plays an important role in the de novo pathway of purine nucleotide biosynthesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP"
        ],
        "length": 427,
        "sequence": "MPSNVIVGLQWGDEGKGKITDLFAKNSDYVVRYQGGNNSGHSIHIRNRHFVLHLIPSGVIYPEVKCIIGPGVVIDPKSLIQEIQNLELMGIDTSQVFLAKRAHITMPYHRLLDRYQEEALGDKSIGTTHRGIGPTYEDKIARIGIRALDLLNLKVFYQKLKYNIDLKNQIFTRIFKKKPLSFQTIYEEYIEYAKILSNRFLDSVYEIHDAFRNKKKILFEGAQAMLLDINYGTYPYVTTSSTSTGGVCTGSGIPPHFLKNFIGITKAYCTRVGFGPFPSEIKNEIGEVIRQKGNEYGATTKRPRRCGWLDLIALKYSCMINGINYLVITKLDVLSELEIIKICIKYKCNEKIIQYFPANLKQNIKGIYIDLPGWKQDISHIHEYKNLPKNCKKYISFIENYLNLEILLISVGSERNQNIIKNKSLFF",
        "proteome": null,
        "gene": "purA",
        "go_terms": [
            {
                "identifier": "GO:0000166",
                "name": "nucleotide binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004019",
                "name": "adenylosuccinate synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006164",
                "name": "purine nucleotide biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005525",
                "name": "GTP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "37cd307e3eb176206c7f16cb37bf0a0b66a13b7b",
        "counters": {
            "domain_architectures": 35081,
            "entries": 20,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "cathgene3d": 3,
                "ncbifam": 2,
                "hamap": 1,
                "panther": 1,
                "prosite": 2,
                "interpro": 7
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 35081
        }
    }
}