HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "M4Q9Q6",
"id": "M4Q9Q6_9EUKA",
"source_organism": {
"taxId": "221721",
"scientificName": "Jakoba bahamiensis",
"fullName": "Jakoba bahamiensis"
},
"name": "Elongation factor Tu",
"description": [
"This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis"
],
"length": 394,
"sequence": "MAKEKFLRNKPHCNIGTIGHVDHGKTTLTAAITKVLSKSGGASFIAYDQIDKAPEEKKRGITISTSHVEYETENRHYAHIDCPGHEDYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPSLVVFLNKVDMVNDEEMIELVEMEVRELLMSYNYPGDEIPIIRGSALMALEGKPEYEQGILNLMKEVDSYIPQPKRDLDKSFLMPIEDVFSISGRGTVVTGRIEQGKLNVGDAVEIVGIHDTIKTTCTGIEMFHKMLDSGEAGDNVGLLLRGIDRTSVVRGQVICHPNSIQPHTEFEAQVYILSKDEGGRHKPFFTNYRPQFFFRTADITGKIELAESVQMVMPGDNVEFKVELIQPCAMNEGMRFAIREGGRTIGAGVVSKILK",
"proteome": null,
"gene": "tufA",
"go_terms": [
{
"identifier": "GO:0003924",
"name": "GTPase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005525",
"name": "GTP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003746",
"name": "translation elongation factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006414",
"name": "translational elongation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "92ee2b1e37c3ba5c8f35a0631c48aafaeefcad09",
"counters": {
"domain_architectures": 38398,
"entries": 33,
"isoforms": 0,
"proteomes": 0,
"sets": 6,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 3,
"pfam": 3,
"profile": 1,
"cdd": 3,
"ncbifam": 5,
"hamap": 1,
"panther": 1,
"prosite": 1,
"prints": 1,
"interpro": 12
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 38398
}
}
}