GET /api/protein/UniProt/M4Q9Q6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "M4Q9Q6",
        "id": "M4Q9Q6_9EUKA",
        "source_organism": {
            "taxId": "221721",
            "scientificName": "Jakoba bahamiensis",
            "fullName": "Jakoba bahamiensis"
        },
        "name": "Elongation factor Tu",
        "description": [
            "This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis"
        ],
        "length": 394,
        "sequence": "MAKEKFLRNKPHCNIGTIGHVDHGKTTLTAAITKVLSKSGGASFIAYDQIDKAPEEKKRGITISTSHVEYETENRHYAHIDCPGHEDYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPSLVVFLNKVDMVNDEEMIELVEMEVRELLMSYNYPGDEIPIIRGSALMALEGKPEYEQGILNLMKEVDSYIPQPKRDLDKSFLMPIEDVFSISGRGTVVTGRIEQGKLNVGDAVEIVGIHDTIKTTCTGIEMFHKMLDSGEAGDNVGLLLRGIDRTSVVRGQVICHPNSIQPHTEFEAQVYILSKDEGGRHKPFFTNYRPQFFFRTADITGKIELAESVQMVMPGDNVEFKVELIQPCAMNEGMRFAIREGGRTIGAGVVSKILK",
        "proteome": null,
        "gene": "tufA",
        "go_terms": [
            {
                "identifier": "GO:0003924",
                "name": "GTPase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005525",
                "name": "GTP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003746",
                "name": "translation elongation factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006414",
                "name": "translational elongation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "92ee2b1e37c3ba5c8f35a0631c48aafaeefcad09",
        "counters": {
            "domain_architectures": 38398,
            "entries": 33,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 6,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 3,
                "pfam": 3,
                "profile": 1,
                "cdd": 3,
                "ncbifam": 5,
                "hamap": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 12
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 38398
        }
    }
}