GET /api/protein/UniProt/M4EFM3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "M4EFM3",
        "id": "M4EFM3_BRACM",
        "source_organism": {
            "taxId": "3711",
            "scientificName": "Brassica campestris",
            "fullName": "Brassica campestris (Field mustard)"
        },
        "name": "Uncharacterized protein",
        "description": null,
        "length": 461,
        "sequence": "MREIQAVETSQPTVAPPAKPSRQLGAQLSGSMSFSSRMSNEDEEMSRTALSAIMAKEEEIEKNKMEIRERVQAQLGRVEEETKRLAFIREELEGLAEPMRKEVALARKKIDSVNKELKNGLSKLGVPRNVLDLMFDWTGANEDYLKVPEAKGSIQAVRNEAFFIPIYELFLTYGGIFRLTFGPKSFLIVSDPSIAKHILKDNAKAYSKQTMVEMFPLRSADAAYGKIKAMLSTLGDPFTRIISPKEYQSFRIGSDGNLQGVGLFINSEPETGRLKLRPDLSLRALEASQRSPHHRAFPDSPCSSNDMLRSSESKIEERVRQILFRLSNDMLRSSESKIEERVRQILFRLQYLSLFRYVHLNPEIYINPKKRQPSGWEVHSTGIHAKTRYIPSFLFMKRSLSRERFCQDQDFHFSSSLTTEDGFNYAIVEDVGYEFKTIQLNQLVRRVLSCFDPKKFSVAVH",
        "proteome": "UP000011750",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0004497",
                "name": "monooxygenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005506",
                "name": "iron ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016705",
                "name": "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0020037",
                "name": "heme binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004014",
                "name": "adenosylmethionine decarboxylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008295",
                "name": "spermidine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "85272800e681d77ac5bf54719b914e736ae352e6",
        "counters": {
            "domain_architectures": 4,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 3,
                "cathgene3d": 2,
                "panther": 1,
                "pfam": 2,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4
        }
    }
}