GET /api/protein/UniProt/M3NJ84/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "M3NJ84",
"id": "M3NJ84_HELPX",
"source_organism": {
"taxId": "1159049",
"scientificName": "Helicobacter pylori GAM265BSii",
"fullName": "Helicobacter pylori GAM265BSii"
},
"name": "Epoxyqueuosine reductase QueH",
"description": [
"Catalyzes the conversion of epoxyqueuosine (oQ) to queuosine (Q), which is a hypermodified base found in the wobble positions of tRNA(Asp), tRNA(Asn), tRNA(His) and tRNA(Tyr)"
],
"length": 368,
"sequence": "MLIHICCSVDNLYFLKKAKEAFVGEKIVGFFYNPNIHPYSEYLLRLEDVKRTCEMLEIELIEGEYELEKFLDKAKGKELLGEKSERCFECFDLRLETSALKAFELGEERFTTTLLTSPKKDPNQLIAKGQHIAQRHNLEFVVFRNDNFEHFKSELDLNLQALARENELYRQNYCGCQFALKIQKESQNRSPFELYSPLKRQILPASIEERTQVFRALEAAKKNDNKPFLAQKTIATYRLLNGGVWLSKNSNPLNCCILARSKSKAKVRINDLRWVFSQRLSALVGYSQRDETLFLTLEGLNTLMAKNYDNLKELNLNPLSYEEELSLRALVSGSESINPIIVLEECIEKTLFVEIKSIFQEEKVFYLL",
"proteome": null,
"gene": "queH",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d268808aa77087735756d236f36856525794a1c1",
"counters": {
"domain_architectures": 5541,
"entries": 4,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"hamap": 1,
"panther": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 5541
}
}
}