General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "M3N3K5",
        "id": "M3N3K5_HELPX",
        "source_organism": {
            "taxId": "1159046",
            "scientificName": "Helicobacter pylori GAM260BSi",
            "fullName": "Helicobacter pylori GAM260BSi"
        },
        "name": "NAD-dependent protein deacylase",
        "description": [
            "NAD-dependent lysine deacetylase and desuccinylase that specifically removes acetyl and succinyl groups on target proteins. Modulates the activities of several proteins which are inactive in their acylated form"
        ],
        "length": 229,
        "sequence": "MKNLVILSGAGISAESGIKTFRDAGGLWEGHDIMEVASPYGWKKNPQKVLDFYNQRHRQLFEVYPNKAHKALAELEKHYQVNIITQNVDDLHERAGSSRILHLHGELLSVRSEKDPNLVYRWEKDLNLGDLAKDKSQLRPDIVWFGEEVPLLKEAISLVKQAHLLIIIGTSLQVYPAASLYTHANKDALIYYIDPKAKNARLPQNVQCINESAVNAMQDLMPKLIEMAS",
        "proteome": null,
        "gene": "cobB",
        "go_terms": [
            {
                "identifier": "GO:0036054",
                "name": "protein-malonyllysine demalonylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0036055",
                "name": "protein-succinyllysine desuccinylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0070403",
                "name": "NAD+ binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d025c4a47877c4dc4d451880aa4615a59586b83c",
        "counters": {
            "domain_architectures": 50198,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "ssf": 1,
                "cdd": 1,
                "cathgene3d": 2,
                "panther": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 50198
        }
    }
}