HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "M3FR52",
"id": "M3FR52_9ACTN",
"source_organism": {
"taxId": "1054862",
"scientificName": "Streptomyces bottropensis ATCC 25435",
"fullName": "Streptomyces bottropensis ATCC 25435"
},
"name": "Zinc carboxypeptidase",
"description": [
"Carboxypeptidase that possesses the specificities of both mammalian Cpase A and B. Thus shows broad substrate specificity, being able to cleave Cbz-Gly-Leu, Cbz-Gly-Val, Cbz-Gly-Phe, Cbz-Gly-Lys and Bz-Gly-Arg in vitro"
],
"length": 457,
"sequence": "MRLRIRGRSATPDGAGRRSGRRTAGLATLLALALAAPVAATTTDATATSAERPRASADDIRQYEVHMHSDSASRTALQRSGVTVDDADDHSVFVSGRADQIKKLRQQGYEITALGAVPDRSHGEDDVRLFDFPSADSRYHNYAEMTNEINSVVAANSSIASQRVIGTTYQGRNIVAIKISDNVGTDEAEPEVLFTHHQHAREHLTVEMALYLLNELTSDYGTDSRVTNMVNNREIWIIPDVNPDGGEYDVATGSYRSWRKNRQPNSGSSAVGTDLNRNWNYRWGCCGGSSGSTSSDTYRGAAAESAPEVKVVANFVRGRVVGGVQQIRSAIDFHTYSELVLWPFGYTTANTTTGMTADDRNAFATVGGKMAASNGYTPEQSSDLYITDGSIDDWLWGNQKIFGYTFEMYPGSASGGGFYPPDEVISRETSRNRDAVLQLLENSDCMYRSIGKEAQYC",
"proteome": null,
"gene": "SBD_4277",
"go_terms": [
{
"identifier": "GO:0004181",
"name": "metallocarboxypeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006508",
"name": "proteolysis",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "407ce68a5ef18dd57466afdcac2992a251f37efc",
"counters": {
"domain_architectures": 38517,
"entries": 14,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"profile": 1,
"smart": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"prosite": 2,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 38517
}
}
}