GET /api/protein/UniProt/M3E2X8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "M3E2X8",
        "id": "M3E2X8_LEPIR",
        "source_organism": {
            "taxId": "1193028",
            "scientificName": "Leptospira interrogans serovar Lora str. TE 1992",
            "fullName": "Leptospira interrogans serovar Lora str. TE 1992"
        },
        "name": "ATP synthase epsilon chain",
        "description": [
            "Produces ATP from ADP in the presence of a proton gradient across the membrane"
        ],
        "length": 127,
        "sequence": "MSANKLKVSVISPEKILYKGEVDSLIVPGSEGFFGILPNHAPLVATLGIGILEIRKGEKLKVLSVEGGFVEIKDNSISILTDHGALKEDIDLEVEKKNLAEAEKLPPSDSKNLFLQKTKTRILVASR",
        "proteome": null,
        "gene": "atpC",
        "go_terms": [
            {
                "identifier": "GO:0015986",
                "name": "proton motive force-driven ATP synthesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0046933",
                "name": "proton-transporting ATP synthase activity, rotational mechanism",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0045259",
                "name": "proton-transporting ATP synthase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0c68a97d8ee5fbc35285347b816ba9f9777c566d",
        "counters": {
            "domain_architectures": 17202,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "ncbifam": 2,
                "panther": 1,
                "hamap": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 17202
        }
    }
}