HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "M2S9J8",
"id": "M2S9J8_COCSN",
"source_organism": {
"taxId": "665912",
"scientificName": "Cochliobolus sativus (strain ND90Pr / ATCC 201652)",
"fullName": "Cochliobolus sativus (strain ND90Pr / ATCC 201652) (Common root rot and spot blotch fungus)"
},
"name": "Zn(2)-C6 fungal-type domain-containing protein",
"description": null,
"length": 395,
"sequence": "MALKLRDSCEACAASKVKCHKQKPTCSRCQRRGTPCHYLATKRTGRRSDSATLSPLAASMLHCEQFDFDSSFSTSTPMSSTYSTDNETFLHQFLTPTSSFPGATYSQSAYDWTSTTPNDGLFTVQPTFAATTLCTSSNSPGFGPGAASPVNLAMDPGGNLPSSVSLWAPTVYETSSVDMPPVLEPGIESQPSAPNLTTPALDTCLTQATKIMQQQFHQSTLGSSNISCKLLKQEGVTNAAGPALDRVIEANKQYINQVDTMLQCQCLNDGYLLTIISLIVFKILDSYGAAASESEVRNAKVGAAEEDVQRIAAQRVMGELHRVQRLVNQLAIHTKRHIAMEFPEMTPGAFRSCGQKEEGEVSSPFSTVKLCQLETDMKKRLRSLSLKLSVHLRKG",
"proteome": "UP000016934",
"gene": "COCSADRAFT_356804",
"go_terms": [
{
"identifier": "GO:0000981",
"name": "DNA-binding transcription factor activity, RNA polymerase II-specific",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0045122",
"name": "aflatoxin biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005634",
"name": "nucleus",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e68185a30f590aeaee6acd5bb466cb7901a3da48",
"counters": {
"domain_architectures": 1360,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"smart": 1,
"cdd": 1,
"ssf": 1,
"profile": 1,
"pfam": 2,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1360
}
}
}