HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "M2N2X9",
"id": "M2N2X9_BAUPA",
"source_organism": {
"taxId": "717646",
"scientificName": "Baudoinia panamericana (strain UAMH 10762)",
"fullName": "Baudoinia panamericana (strain UAMH 10762) (Angels' share fungus)"
},
"name": "V-type proton ATPase subunit F",
"description": [
"Subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments"
],
"length": 124,
"sequence": "MALPQSAYKDREFLAVIGDEDSVTGILLAGVGHVTDPPDSQRNYLVVDQKTETSTIEGAFDSFTKQRKDIAIVLINQHIADKIRGRVDGYSEAFPSILEIPSKDHPYDPEKDSVMKRVRKLFGE",
"proteome": "UP000011761",
"gene": "BAUCODRAFT_237312",
"go_terms": [
{
"identifier": "GO:0034220",
"name": "monoatomic ion transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0046961",
"name": "proton-transporting ATPase activity, rotational mechanism",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:1902600",
"name": "proton transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0033180",
"name": "proton-transporting V-type ATPase, V1 domain",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "06d4784b2e6318c50671b6dc0edecc495f96d68c",
"counters": {
"domain_architectures": 7515,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"pirsf": 1,
"ncbifam": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 7515
}
}
}