GET /api/protein/UniProt/M1PRE0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "M1PRE0",
        "id": "M1PRE0_9TELE",
        "source_organism": {
            "taxId": "352917",
            "scientificName": "Pseudohemiculter dispar",
            "fullName": "Pseudohemiculter dispar"
        },
        "name": "NADH-ubiquinone oxidoreductase chain 3",
        "description": [
            "Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Essential for the catalytic activity of complex I"
        ],
        "length": 116,
        "sequence": "MNLIMTILTITMALSSILAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILFLLFDLEIALLLPLPWGDQLHNPAGTFFWATTVLILLTLGLIYEWTQGGLEWAE",
        "proteome": null,
        "gene": "ND3",
        "go_terms": [
            {
                "identifier": "GO:0008137",
                "name": "NADH dehydrogenase (ubiquinone) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e9a5b42e32de65bd6bc464b4186c01128f5abeb7",
        "counters": {
            "domain_architectures": 65483,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 65483
        }
    }
}