General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "M1LBF8",
        "id": "M1LBF8_9PROT",
        "source_organism": {
            "taxId": "1208922",
            "scientificName": "Candidatus Kinetoplastidibacterium blastocrithidiae TCC012E",
            "fullName": "Candidatus Kinetoplastidibacterium blastocrithidiae TCC012E"
        },
        "name": "Ribonuclease HII",
        "description": [
            "Endonuclease that specifically degrades the RNA of RNA-DNA hybrids"
        ],
        "length": 192,
        "sequence": "MNEYLNIIAGVDEAGRGALAGPVYAAAVVLDYRYRIEGLDDSKKLTPKKREQLSAIIKQKSICWSVSSIDVNEIDRINILQATLLAMKNAILKLKRQPNLVLVDGNQSPELEYKVLKIVKGDSFVPAISAASILAKTERDKEMLNLHYQYPSYLFNKHKGYGTQEHMILLKNHGPCKEHRKSFSPVKDLINM",
        "proteome": "UP000011563",
        "gene": "rnhB",
        "go_terms": [
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004523",
                "name": "RNA-DNA hybrid ribonuclease activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "be57e75a8d1d76f6feea61410b1a5573546b0a8f",
        "counters": {
            "domain_architectures": 28247,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "pfam": 1,
                "cdd": 1,
                "ncbifam": 3,
                "panther": 1,
                "hamap": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 28247
        }
    }
}