General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "M0MW04",
        "id": "M0MW04_9EURY",
        "source_organism": {
            "taxId": "1227457",
            "scientificName": "Halococcus thailandensis JCM 13552",
            "fullName": "Halococcus thailandensis JCM 13552"
        },
        "name": "Flavin-dependent thymidylate synthase",
        "description": [
            "Catalyzes the reductive methylation of 2'-deoxyuridine-5'-monophosphate (dUMP) to 2'-deoxythymidine-5'-monophosphate (dTMP) while utilizing 5,10-methylenetetrahydrofolate (mTHF) as the methyl donor, and NADPH and FADH(2) as the reductant"
        ],
        "length": 247,
        "sequence": "MDVRLLEATDDPERVICTAARSDYSSGFVGEQSFAETMSTVDGETIEEKKRTLVGRLLDHGHFGPFEHPQATFGVKGISRSCMAQLTRHRHVSFDVQSMRYVSFDEVDPADVREGAMIVTPPSATDPDWVGRNQSGGAVDDEVVEKRERIFRESVTESVESYQELLDTGMPPEDARFVLPIGTEVNMVLSMNVRMLMHVADMRAAADSQWEIRHLTESILDHAAEWCPLTFAHYDEQMKGRKNRLAP",
        "proteome": "UP000011680",
        "gene": "thyX",
        "go_terms": [
            {
                "identifier": "GO:0050660",
                "name": "flavin adenine dinucleotide binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0050797",
                "name": "thymidylate synthase (FAD) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006231",
                "name": "dTMP biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "04840fd37d530bca727bb00ea092349a854c8917",
        "counters": {
            "domain_architectures": 9312,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "profile": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 9312
        }
    }
}