HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "L9YQJ5",
"id": "L9YQJ5_9EURY",
"source_organism": {
"taxId": "1227495",
"scientificName": "Natrinema pallidum DSM 3751",
"fullName": "Natrinema pallidum DSM 3751"
},
"name": "Ketol-acid reductoisomerase (NADP(+))",
"description": [
"Involved in the biosynthesis of branched-chain amino acids (BCAA). Catalyzes an alkyl-migration followed by a ketol-acid reduction of (S)-2-acetolactate (S2AL) to yield (R)-2,3-dihydroxy-isovalerate. In the isomerase reaction, S2AL is rearranged via a Mg-dependent methyl migration to produce 3-hydroxy-3-methyl-2-ketobutyrate (HMKB). In the reductase reaction, this 2-ketoacid undergoes a metal-dependent reduction by NADPH to yield (R)-2,3-dihydroxy-isovalerate"
],
"length": 351,
"sequence": "MTDEFTTDMYYDDDAAVSTLDDDTVAVLGYGSQGHAHALNLHESGVDVVVGLREGSSSRSAAEADGLPVETPAEAVSQASYVSVLVPDTVQADVYENAIAPNLEAGDTLQFAHGLNIHYNQIEPPEDVDVTMVAPKSPGHLVRRNYENDEGTPGLLAVYQDTTGDADERALAYAKGIGCTRAGVIETTFREEVESDLFGEQAVLCGGVTSLVKHGYETLVDAGYSPEIAYFECLNELKLIVDLMYEGGHAEMWDSVSDTAEYGGLSRGDRIVDENVRENMEETLEEIQNGEFTREWILENQAGRPSYNQLRESEKNHEIEAVGERLRDLFAWAEDEPTETDDESVPVQADD",
"proteome": null,
"gene": "ilvC",
"go_terms": [
{
"identifier": "GO:0004455",
"name": "ketol-acid reductoisomerase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009082",
"name": "branched-chain amino acid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0050661",
"name": "NADP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "23be5c984df3ce0fb023b39c00f37e3a52a70888",
"counters": {
"domain_architectures": 21735,
"entries": 20,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"profile": 2,
"ssf": 2,
"pfam": 2,
"hamap": 1,
"ncbifam": 3,
"panther": 1,
"pirsf": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 21735
}
}
}