General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "L9KU94",
        "id": "L9KU94_TUPCH",
        "source_organism": {
            "taxId": "246437",
            "scientificName": "Tupaia chinensis",
            "fullName": "Tupaia chinensis (Chinese tree shrew)"
        },
        "name": "rRNA biogenesis protein RRP36",
        "description": [
            "Component of the 90S pre-ribosome involved in the maturation of rRNAs. Required for early cleavages of the pre-RNAs in the 40S ribosomal subunit maturation pathway"
        ],
        "length": 255,
        "sequence": "MPRAVPRARAVARCPRQAQDSGESDDTLEPRVVASDLRRDTSNMSFEELLELQSHVGTKTYKQLVAGNSSKKPNSRPSVQSACVSDKHRPLEMSAKVRVPFLRQVVPISKKVARDPRFDDLSGEYNPEVFDKTYQFLNDIRAKEKELVKKQLKKHHSGEKHEKLQQLLQRMEQQEKAEQERKRQQELRLTLKQERRAQAQQGHRPYFLKKSEQRQLTLAEKFKELKRSKKLESFLSRKRRRNAGKDRRHLPLSKE",
        "proteome": "UP000011518",
        "gene": "TREES_T100014846",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4ba46bb20216e344a3a4efd4ba52ccd09b2bc16d",
        "counters": {
            "domain_architectures": 4268,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4268
        }
    }
}