General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "L8XZ25",
        "id": "L8XZ25_TUPCH",
        "source_organism": {
            "taxId": "246437",
            "scientificName": "Tupaia chinensis",
            "fullName": "Tupaia chinensis (Chinese tree shrew)"
        },
        "name": "G1/S-specific cyclin-D2",
        "description": [
            "Regulatory component of the cyclin D2-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals"
        ],
        "length": 289,
        "sequence": "MELLCCEVDPVRRAVPDRNLLQDDRVLQNLLSIEERYLPQCSYFKCVQKDLQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETIPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPPQREKMSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQHDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEEVLLNSLQQYRQDQRDGSKSEDELDQATTPTDVRDIDL",
        "proteome": "UP000011518",
        "gene": "TREES_T100006089",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fd1efc4a1ce5c8e2dc0db0172d8c97e704be840e",
        "counters": {
            "domain_architectures": 39207,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 2,
                "smart": 2,
                "cdd": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 39207
        }
    }
}