GET /api/protein/UniProt/L8I2Y0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "L8I2Y0",
"id": "L8I2Y0_9CETA",
"source_organism": {
"taxId": "72004",
"scientificName": "Bos mutus",
"fullName": "Bos mutus (wild yak)"
},
"name": "H/ACA ribonucleoprotein complex subunit 2",
"description": [
"Common component of the spliceosome and rRNA processing machinery",
"Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Each rRNA can contain up to 100 pseudouridine ('psi') residues, which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme"
],
"length": 159,
"sequence": "VATVAAMTKIKADPDGPEAQADACCGERTYHELLVNLNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFINKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQALPPPM",
"proteome": null,
"gene": "M91_05855",
"go_terms": [
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005730",
"name": "nucleolus",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e648c895252343045e836caf4ce7bf2296aeba99",
"counters": {
"domain_architectures": 43462,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"panther": 1,
"prints": 2,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 43462
}
}
}