GET /api/protein/UniProt/L8EUI6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "L8EUI6",
"id": "L8EUI6_STRR1",
"source_organism": {
"taxId": "1265868",
"scientificName": "Streptomyces rimosus subsp. rimosus (strain ATCC 10970 / DSM 40260 / JCM 4667 / NRRL 2234)",
"fullName": "Streptomyces rimosus subsp. rimosus (strain ATCC 10970 / DSM 40260 / JCM 4667 / NRRL 2234)"
},
"name": "2-deoxy-scyllo-inosamine dehydrogenase",
"description": [
"Catalyzes the oxidation of 2-deoxy-scyllo-inosamine (DOIA) with NAD(+) or NADP(+), forming 3-amino-2,3-dideoxy-scyllo-inosose (amino-DOI)"
],
"length": 338,
"sequence": "MKALVLTERRTVSLVDHPKPAATAPDDVVVRVVQTGICGTDRSVLVGKFPAEPGVVMGHEAVGTVEEAGAAVTAHKPGDRVVINPTLYCGSCPPCLRGHWDFCANKAGTEVGLDLDGAFAEFIRLPERFVHAVPEGMDFDRAVGVEPLACALNNVEAGRLRAGETAVIVGGGPVGVVCAMAAHYYGARVLLTEPDPYRQELCREVFAGDFGGRVTVRPPDDPDLAGRGDVVIDTVGNLLEQSMAYAATRGRVVVMGYNSKASATVRPLEILQRGLQIIGAGDYNSRLFPRAIELARWLPLERLVTHRFPLERHEEAFAALAAAPGSPYSALKVVLVPE",
"proteome": null,
"gene": "SRIM_031735",
"go_terms": [
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6e6b076d581cf5733167d9dad5b9a31c66e6d8d3",
"counters": {
"domain_architectures": 323634,
"entries": 16,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"smart": 1,
"cathgene3d": 2,
"pfam": 2,
"panther": 1,
"prosite": 1,
"interpro": 7
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 323634
}
}
}