GET /api/protein/UniProt/L8EUI6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "L8EUI6",
        "id": "L8EUI6_STRR1",
        "source_organism": {
            "taxId": "1265868",
            "scientificName": "Streptomyces rimosus subsp. rimosus (strain ATCC 10970 / DSM 40260 / JCM 4667 / NRRL 2234)",
            "fullName": "Streptomyces rimosus subsp. rimosus (strain ATCC 10970 / DSM 40260 / JCM 4667 / NRRL 2234)"
        },
        "name": "2-deoxy-scyllo-inosamine dehydrogenase",
        "description": [
            "Catalyzes the oxidation of 2-deoxy-scyllo-inosamine (DOIA) with NAD(+) or NADP(+), forming 3-amino-2,3-dideoxy-scyllo-inosose (amino-DOI)"
        ],
        "length": 338,
        "sequence": "MKALVLTERRTVSLVDHPKPAATAPDDVVVRVVQTGICGTDRSVLVGKFPAEPGVVMGHEAVGTVEEAGAAVTAHKPGDRVVINPTLYCGSCPPCLRGHWDFCANKAGTEVGLDLDGAFAEFIRLPERFVHAVPEGMDFDRAVGVEPLACALNNVEAGRLRAGETAVIVGGGPVGVVCAMAAHYYGARVLLTEPDPYRQELCREVFAGDFGGRVTVRPPDDPDLAGRGDVVIDTVGNLLEQSMAYAATRGRVVVMGYNSKASATVRPLEILQRGLQIIGAGDYNSRLFPRAIELARWLPLERLVTHRFPLERHEEAFAALAAAPGSPYSALKVVLVPE",
        "proteome": null,
        "gene": "SRIM_031735",
        "go_terms": [
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6e6b076d581cf5733167d9dad5b9a31c66e6d8d3",
        "counters": {
            "domain_architectures": 323634,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "smart": 1,
                "cathgene3d": 2,
                "pfam": 2,
                "panther": 1,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 323634
        }
    }
}