GET /api/protein/UniProt/L7XZW3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "L7XZW3",
        "id": "L7XZW3_9BRYO",
        "source_organism": {
            "taxId": "487416",
            "scientificName": "Syntrichia norvegica",
            "fullName": "Syntrichia norvegica"
        },
        "name": "Ribulose bisphosphate carboxylase large chain",
        "description": [
            "RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate in the photorespiration process. Both reactions occur simultaneously and in competition at the same active site"
        ],
        "length": 205,
        "sequence": "GVGFKAGVKDYRLNYYTPDYQTKETDILAAFRMTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEAVPGEENQYIVYVAYPLDLFEEGSVTNLFTSIVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRW",
        "proteome": null,
        "gene": "rbcL",
        "go_terms": [
            {
                "identifier": "GO:0016984",
                "name": "ribulose-bisphosphate carboxylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015977",
                "name": "carbon fixation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0000287",
                "name": "magnesium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e63944c3623b42c86664bd4f37e98e933668bb32",
        "counters": {
            "domain_architectures": 163136,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 2,
                "panther": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 163136
        }
    }
}