GET /api/protein/UniProt/L7VQM1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "L7VQM1",
        "id": "L7VQM1_THES1",
        "source_organism": {
            "taxId": "1121335",
            "scientificName": "Thermoclostridium stercorarium (strain ATCC 35414 / DSM 8532 / NCIMB 11754)",
            "fullName": "Thermoclostridium stercorarium (strain ATCC 35414 / DSM 8532 / NCIMB 11754)"
        },
        "name": "Protein translocase subunit SecE",
        "description": [
            "Essential subunit of the Sec protein translocation channel SecYEG. Clamps together the 2 halves of SecY. May contact the channel plug during translocation"
        ],
        "length": 74,
        "sequence": "MFLMAEQVQKKPSVYKRFVKFVKEVRSELKKVIWPSRSQLINYTLTVIVICLILGVVVWLFDALFGFLYTLVFA",
        "proteome": "UP000011220",
        "gene": "secE",
        "go_terms": [
            {
                "identifier": "GO:0008320",
                "name": "protein transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009306",
                "name": "protein secretion",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0006605",
                "name": "protein targeting",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006886",
                "name": "intracellular protein transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0d41e4e71441ccac4f46a43da1a097dd754b8912",
        "counters": {
            "domain_architectures": 28756,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "pfam": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 28756
        }
    }
}