GET /api/protein/UniProt/L7P5W3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "L7P5W3",
        "id": "L7P5W3_9ARAE",
        "source_organism": {
            "taxId": "1189060",
            "scientificName": "Colocasia formosana",
            "fullName": "Colocasia formosana"
        },
        "name": "Protein TIC 214",
        "description": [
            "Involved in protein precursor import into chloroplasts. May be part of an intermediate translocation complex acting as a protein-conducting channel at the inner envelope"
        ],
        "length": 70,
        "sequence": "MKVKKSSYNNREIARQKKRRRFVMILKFFLLGNPLSLCMKIINSVVIVGLYYGFITTFSIGPSYLFLLRA",
        "proteome": null,
        "gene": "ycf1",
        "go_terms": [
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "089a864ad0f8e3228f7f15576c78e8b1f667e785",
        "counters": {
            "domain_architectures": 15303,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 15303
        }
    }
}