GET /api/protein/UniProt/L7P5W3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "L7P5W3",
"id": "L7P5W3_9ARAE",
"source_organism": {
"taxId": "1189060",
"scientificName": "Colocasia formosana",
"fullName": "Colocasia formosana"
},
"name": "Protein TIC 214",
"description": [
"Involved in protein precursor import into chloroplasts. May be part of an intermediate translocation complex acting as a protein-conducting channel at the inner envelope"
],
"length": 70,
"sequence": "MKVKKSSYNNREIARQKKRRRFVMILKFFLLGNPLSLCMKIINSVVIVGLYYGFITTFSIGPSYLFLLRA",
"proteome": null,
"gene": "ycf1",
"go_terms": [
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "089a864ad0f8e3228f7f15576c78e8b1f667e785",
"counters": {
"domain_architectures": 15303,
"entries": 2,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 15303
}
}
}