GET /api/protein/UniProt/L7JBQ5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "L7JBQ5",
"id": "L7JBQ5_PYRO1",
"source_organism": {
"taxId": "1143193",
"scientificName": "Pyricularia oryzae (strain P131)",
"fullName": "Pyricularia oryzae (strain P131) (Rice blast fungus)"
},
"name": "Uncharacterized protein",
"description": [
"Required for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum"
],
"length": 111,
"sequence": "MATRRIVATEKSILEKDDHIGSSPAAGEKSNITPAVPLDVILKLLAFTLAMVVIPIGSYFVTVNSIFKGNSTYAGALAAIMANVVLVAYVVVAMNEDQTEQEKAKEGKKDR",
"proteome": null,
"gene": "OOW_P131scaffold00481g7",
"go_terms": [
{
"identifier": "GO:0070072",
"name": "vacuolar proton-transporting V-type ATPase complex assembly",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "179986e03afdcbedde8c358346371e5bb95ab699",
"counters": {
"domain_architectures": 3865,
"entries": 4,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"hamap": 1,
"panther": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 3865
}
}
}