HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "L5LFZ6",
"id": "L5LFZ6_MYODS",
"source_organism": {
"taxId": "225400",
"scientificName": "Myotis davidii",
"fullName": "Myotis davidii (David's myotis)"
},
"name": "cysteine--tRNA ligase",
"description": [
"In addition to its role as an aminoacyl-tRNA synthetase, has also cysteine persulfide synthase activity. Produces reactive persulfide species such as cysteine persulfide (CysSSH) from substrate cysteine and mediate direct incorporation of CysSSH into proteins during translations, resulting in protein persulfides and polysulfides. CysSSHs behave as potent antioxidants and cellular protectants",
"Mitochondrial cysteine-specific aminoacyl-tRNA synthetase that catalyzes the ATP-dependent ligation of cysteine to tRNA(Cys)"
],
"length": 450,
"sequence": "MVMGITDVDDKIIKRANEMKISPASLANLYEEDFKQDMAALKVLPPTVYLRVTENIPQIISFIEGIIANGHAYSTARGNVYFDLQSRGDKYGKLVGVAPGPVAEPGDSDKRHASDFALWKAAKPQEVFWPSPWGNGRPGWHIECSTISSLVFGSQLDIHSGGIDLAFPHHENEIAQCEVFHQCQQWGNYFLHSGHLHVKGKEEKMSKSLKNYITIKDFLKTFSPDVFRLFCLRSSYRSAVDYSDSTMQEAQHLLRALAAFAQDARAYMKGQLVCGPIREDVLWERLNHTQAAVKAALADDFDTPGAVDAVLDLIHQANRQLKVVTKEPGGPRSPAVFGSIISYVEQFFETVGISLAERQFVSGDSSSAMLHSVVEELVRFRLKVRQFALATGEATKEVRRQQLLERQPLLEACDTLRQDLAAHGISIKDRSSTSTWELLGQRSEDHKPGS",
"proteome": "UP000010556",
"gene": "MDA_GLEAN10017041",
"go_terms": [
{
"identifier": "GO:0000166",
"name": "nucleotide binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004812",
"name": "aminoacyl-tRNA ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006418",
"name": "tRNA aminoacylation for protein translation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004817",
"name": "cysteine-tRNA ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006423",
"name": "cysteinyl-tRNA aminoacylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "113829688c91e62e0f52ce7894c8bd7fd50fd5da",
"counters": {
"domain_architectures": 6725,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"pfam": 2,
"panther": 1,
"ncbifam": 1,
"prints": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 6725
}
}
}