GET /api/protein/UniProt/L2F644/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "L2F644",
"id": "L2F644_9GAMM",
"source_organism": {
"taxId": "1230338",
"scientificName": "Moraxella macacae 0408225",
"fullName": "Moraxella macacae 0408225"
},
"name": "Arginine biosynthesis bifunctional protein ArgJ",
"description": [
"Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate"
],
"length": 400,
"sequence": "MPVGNVNLSKLLPIKGIKIGVTEAHIRYPNRKDLTVFEICQHASVAVVTTQNQFCASPVKLVREFIKTDTPRYLLINTGNANAGTGKDGDMRALATCQALANKTGVKPSQVLPYSTGVIGETLPSDKIIAGLDKLLANLTHSQAQDNWLNCAYSIMTTDTIPKGHSETVTIDDITYTVTGVSKGAGMIRPNMATMLGFVATDANIDKNLLQDMLIKIVNKTFNRISVDGDTSTNDCCTLIATGQVGDLIDSENHAHYMPIYQAIYKVMLTIATLIVRDGEGATKFITVKVTGGKNTADCTKIAYSIAHSPLVKTAFFASDPNWGRILAAAGYAGVDFDQSKVSVALDEVKICERGGLADGYTEPLGLEVMTRPEITIHIDLGCGGGQVIQCILVIYHTIM",
"proteome": "UP000023795",
"gene": "argJ",
"go_terms": [
{
"identifier": "GO:0004358",
"name": "L-glutamate N-acetyltransferase activity, acting on acetyl-L-ornithine as donor",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006526",
"name": "L-arginine biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "786eedc3d667c9a65d4335fc8459a6c268e2b6f6",
"counters": {
"domain_architectures": 20269,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"cdd": 1,
"ssf": 1,
"hamap": 1,
"ncbifam": 2,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 20269
}
}
}