HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "L0KR47",
"id": "L0KR47_MESAW",
"source_organism": {
"taxId": "754035",
"scientificName": "Mesorhizobium australicum (strain HAMBI 3006 / LMG 24608 / WSM2073)",
"fullName": "Mesorhizobium australicum (strain HAMBI 3006 / LMG 24608 / WSM2073)"
},
"name": "6,7-dimethyl-8-ribityllumazine synthase",
"description": [
"Catalyzes the formation of 6,7-dimethyl-8-ribityllumazine by condensation of 5-amino-6-(D-ribitylamino)uracil with 3,4-dihydroxy-2-butanone 4-phosphate. This is the penultimate step in the biosynthesis of riboflavin"
],
"length": 157,
"sequence": "MNQHSHKDYETIRIAVIRARWHADIVDQCVQAFGAELAEIGGGRFAVDIFDVPGAYEIPLHAKTLAGTGRYAAILGTAFVVNGGIYRHDFVANAVIDGMMNVQLSTGVPVLSAVLTPHNFHDSAEHHRFFFEHFTVKGKEAANACVQILAAREKIAA",
"proteome": "UP000010998",
"gene": "ribH",
"go_terms": [
{
"identifier": "GO:0009231",
"name": "riboflavin biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009349",
"name": "riboflavin synthase complex",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0000906",
"name": "6,7-dimethyl-8-ribityllumazine synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d01ee23fcf6eb1d574b1734fb57204187d85d9d5",
"counters": {
"domain_architectures": 26163,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"cdd": 1,
"ncbifam": 1,
"panther": 1,
"hamap": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 26163
}
}
}