General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "L0DCT7",
        "id": "L0DCT7_SINAD",
        "source_organism": {
            "taxId": "886293",
            "scientificName": "Singulisphaera acidiphila (strain ATCC BAA-1392 / DSM 18658 / VKM B-2454 / MOB10)",
            "fullName": "Singulisphaera acidiphila (strain ATCC BAA-1392 / DSM 18658 / VKM B-2454 / MOB10)"
        },
        "name": "Ribonucleotide monophosphatase NagD",
        "description": [
            "Catalyzes the dephosphorylation of an unusually broad range of substrate including deoxyribo- and ribonucleoside tri-, di-, and monophosphates, as well as polyphosphate and glucose-1-P (Glu1P)"
        ],
        "length": 256,
        "sequence": "MPPSYIVDMDGVIYHGHRLIPGVLDFLERLRRGGHKFLFLTNNSQWTPRDLSHRLSQIGIDVDESSFHTSALATADFLHRQKPGGTAYVIGGAGLTHALYSVGYTLTEHKPDYVVVGDTRSYDFEKIERASRLVAGGARFVATNLDLTGPSEQGIQPACGALVAPIELVTGRKPYFVGKPNPLMMRTALRKLDAHSADSFMVGDRMDTDILAGTEAGMRTILVLSGVSSRETVEQYPFRPTFIFENVGEIPVESLT",
        "proteome": "UP000010798",
        "gene": "Sinac_2373",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e39eac487bc4db226689882ed9a0cd550bf387a9",
        "counters": {
            "domain_architectures": 32478,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 2,
                "panther": 1,
                "sfld": 2,
                "ncbifam": 1,
                "pirsf": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 32478
        }
    }
}