General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "K9YUV7",
        "id": "K9YUV7_DACS8",
        "source_organism": {
            "taxId": "13035",
            "scientificName": "Dactylococcopsis salina (strain PCC 8305)",
            "fullName": "Dactylococcopsis salina (strain PCC 8305)"
        },
        "name": "Cyanate hydratase",
        "description": [
            "Catalyzes the reaction of cyanate with bicarbonate to produce ammonia and carbon dioxide"
        ],
        "length": 147,
        "sequence": "MPVAEITEKLLAAKKEKGITFEDLEKQVGRDEVWIASVIYRQASADMEEAKKIVSALGLPESMAEPLTVPPMKGGLEPQVPTDPLVYRFYEIMQVYGMPVKDVIHEKFGDGIMSAIDFSIEVDRVEDPKGDRVQITMCGKFLPYKKW",
        "proteome": "UP000010482",
        "gene": "cynS",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009440",
                "name": "cyanate catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008824",
                "name": "cyanate hydratase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f8e3eab37ce2e4e7d0eab361a76eb7e715f8b4f5",
        "counters": {
            "domain_architectures": 4123,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 2,
                "cdd": 2,
                "smart": 1,
                "hamap": 1,
                "ncbifam": 2,
                "pirsf": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4123
        }
    }
}