HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "K9XZB4",
"id": "K9XZB4_STAC7",
"source_organism": {
"taxId": "111780",
"scientificName": "Stanieria cyanosphaera (strain ATCC 29371 / PCC 7437)",
"fullName": "Stanieria cyanosphaera (strain ATCC 29371 / PCC 7437)"
},
"name": "Anthranilate synthase component 1",
"description": [
"Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia"
],
"length": 509,
"sequence": "MIFPDFTQFSALAQQGNFVPVYQELVADLETPVSAWYKVCAGQPYSFLLESVEGGETLGRYSFLGCDPVWVLEARGEVTTQTYRDGLVKNFNGNPFEILAQCLEPIKPVKLPQLPPGIGGLFGVWGYELIRWIEPRVPVYEPTSEDLPDGVWMQVDNLIIFDQVKRKIWAIAYADLRETNTDVRQAYQEACDRAAKLVLKLQLPLPVEAKSLEWKATDQYTEQPPLTYSSNTSEELFCQNVLKAKDYIRAGDIFQVVLSQRLSTTYTGHPFNLYRSLRVVNPSPYMAYYQFNDWQLIGSSPEVMVKAERWENNKIKATLRPIAGTRKRGINQTQDRALAEDLLQDPKEIAEHVMLVDLGRNDLGRVCVKGSVTVDELMVIERYSHVMHIVSNVIGELEANKTAWDLLKACFPAGTVSGAPKIRAMEIINELEPERRGPYSGVYGYYDFEGQLNSAITIRTMVVRPQSNNRHLVSVQAGAGLVADSVPEQEYQETLNKARGLLEAIRSLN",
"proteome": "UP000010473",
"gene": "trpE",
"go_terms": [
{
"identifier": "GO:0009058",
"name": "biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004049",
"name": "anthranilate synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000162",
"name": "L-tryptophan biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5d92610f78d2cdf7f6abcb01205c4d99be64ab41",
"counters": {
"domain_architectures": 33624,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 2,
"panther": 1,
"ncbifam": 1,
"prints": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 33624
}
}
}