HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "K9XZ25",
"id": "K9XZ25_STAC7",
"source_organism": {
"taxId": "111780",
"scientificName": "Stanieria cyanosphaera (strain ATCC 29371 / PCC 7437)",
"fullName": "Stanieria cyanosphaera (strain ATCC 29371 / PCC 7437)"
},
"name": "Lipid II isoglutaminyl synthase (glutamine-hydrolyzing) subunit GatD",
"description": [
"The lipid II isoglutaminyl synthase complex catalyzes the formation of alpha-D-isoglutamine in the cell wall lipid II stem peptide. The GatD subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia. The resulting ammonia molecule is channeled to the active site of MurT"
],
"length": 265,
"sequence": "MMELTIGWLYPNLMSTYGDRGNVICLQRRCQWRGIQAKILPLDRQTDAEQFKQVDIIVGGGAQDRQQEIVMRDLKGEKAKALKAKIETGTPGVFTCGSPQLLGHYYEPALGQKIEGLGLLDLVSKHPGIDAKRCIGNVVFEITASPLAEDLKTSLGTQPLVIGFENHGGRTYLNNVAALGKVIKGYGNNGEDGTEGAFYRNAIATYSHGPLLPKNPFLADWLIKTSLQQKYQQEISLTKLEDNLAVAARKAMLQRLDLSNINATI",
"proteome": "UP000010473",
"gene": "gatD",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009236",
"name": "cobalamin biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004359",
"name": "glutaminase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0071555",
"name": "cell wall organization",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1a40f0f60050d47cbc7301325546e0e62f478d9f",
"counters": {
"domain_architectures": 7121,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"cdd": 1,
"ssf": 1,
"hamap": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 7121
}
}
}