HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "K9MES4",
"id": "K9MES4_9HYME",
"source_organism": {
"taxId": "1127269",
"scientificName": "Habralictus sp. JG-2011",
"fullName": "Habralictus sp. JG-2011"
},
"name": "Sodium/potassium-transporting ATPase subunit alpha",
"description": [
"This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassium ions, providing the energy for active transport of various nutrients"
],
"length": 490,
"sequence": "AILCFIAYSIQATTSEDPSDDNLFLGIVLAVVVIVTGIFSYYQESKSSKIMESFKNMVPQYATVIREGEKLMLRAEELVLGDVVEVKFGDRIPADIRIIESRGFKVDNSSLTGESEPQSRSPEFTNENPLETKNLAFFSTNAVEGTAKGVVICCGDQTVMGRIAGLASGLDTGETPIAKEIHHFIHLITGVAVFLGVTFFVIAFILGYHWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIIEADTTEDQSGLQYDRTSPGFKALAKIATLCNRAEFKSGQENMPILQRGVNGDASEAALLKCMELALGDVMGIRKRNKKVCEVPFNSTNKYQVSVHESDNPDDPRHLLVMKGAPERILDRCASIFIGGKEKVLDEEMKEAFNNAYLELGGLGERVLGFCDFILPSDKFPLGFKFNSDDPNFPVDGLRFVGLMSMIDPPRA",
"proteome": null,
"gene": "NaK",
"go_terms": [
{
"identifier": "GO:0000166",
"name": "nucleotide binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008556",
"name": "P-type potassium transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006813",
"name": "potassium ion transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0005215",
"name": "transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016887",
"name": "ATP hydrolysis activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8a01453701111a747ebdcb49cd91359409c40e8b",
"counters": {
"domain_architectures": 3026,
"entries": 22,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 3,
"cathgene3d": 3,
"pfam": 2,
"ncbifam": 2,
"panther": 1,
"prints": 2,
"prosite": 1,
"interpro": 8
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 3026
}
}
}