GET /api/protein/UniProt/K9MES0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "K9MES0",
        "id": "K9MES0_9HYME",
        "source_organism": {
            "taxId": "1127265",
            "scientificName": "Caenohalictus sp. 2 JG-2011",
            "fullName": "Caenohalictus sp. 2 JG-2011"
        },
        "name": "Na(+)/K(+)-exchanging ATPase",
        "description": [
            "This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassium ions, providing the energy for active transport of various nutrients"
        ],
        "length": 208,
        "sequence": "AILCFIAYSIQATTSEDPSDDNLFLGIVLAVVVIVTGIFSYYQESKSSKIMESFKNMVPQYATVIREGEKLMLRAEELVLGDVVEVKFGDRIPADIRIIESRGFKVDNSSLTGESEPQSRSPEFTNENPLETKNLAFFSTNAVEGTAKGVVICCGDQTVMGRIAGLASGLDTGETPIAKEIHHFIHLITGVAVFLGVTFFVIAFILGY",
        "proteome": null,
        "gene": "NaK",
        "go_terms": [
            {
                "identifier": "GO:0005215",
                "name": "transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016887",
                "name": "ATP hydrolysis activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c5300d6462ef9f916c52cfe007a059c51fc9392b",
        "counters": {
            "domain_architectures": 6493,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 6493
        }
    }
}