GET /api/protein/UniProt/K9IGF9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "K9IGF9",
        "id": "K9IGF9_DESRO",
        "source_organism": {
            "taxId": "9430",
            "scientificName": "Desmodus rotundus",
            "fullName": "Desmodus rotundus (Vampire bat)"
        },
        "name": "LIM domain transcription factor LMO4",
        "description": [
            "Transcription cofactor. Plays a role in establishing motor neuron identity, in concert with MNX1, acting, at least in part, to disrupt LDB1-LHX3 complexes thereby negatively modulating interneuron genes in motor neurons"
        ],
        "length": 197,
        "sequence": "MVNPGSSTQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVXLKGQSNAECVPSSQILFITGGSHVSSVAKSPL",
        "proteome": null,
        "gene": null,
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "ef2d731db6a1b8f96953a4ec09c9bfdcbe4db090",
        "counters": {
            "domain_architectures": 21131,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "profile": 1,
                "smart": 1,
                "cdd": 2,
                "pfam": 1,
                "cathgene3d": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 21131
        }
    }
}