GET /api/protein/UniProt/K9FT03/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "K9FT03",
"id": "K9FT03_PEND2",
"source_organism": {
"taxId": "1170229",
"scientificName": "Penicillium digitatum (strain PHI26 / CECT 20796)",
"fullName": "Penicillium digitatum (strain PHI26 / CECT 20796) (Green mold)"
},
"name": "Nuclear transport factor 2",
"description": [
"Facilitates protein transport into the nucleus. Could be part of a multicomponent system of cytosolic factors that assemble at the pore complex during nuclear import",
"Has a role in nuclear-cytoplasmic transport of proteins and mRNAs"
],
"length": 125,
"sequence": "MADFNAIAQQFVQFYYQTFDGNRAGLAGLYRDQSMLTFETSSVQGVSAITEKLSALPFQKVQHQIATFDAQPSSGDGIVVLVTGALLVDEEQKPMNYTQCFKLQPDGAGSYFVLNDVFRLIYSAQ",
"proteome": "UP000009882",
"gene": "PDIG_80500",
"go_terms": [
{
"identifier": "GO:0006913",
"name": "nucleocytoplasmic transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "afbad8af13c47d1f38e411b81ab56acd5f1b4e87",
"counters": {
"domain_architectures": 10709,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"profile": 1,
"pfam": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 10709
}
}
}