General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "K9FT03",
        "id": "K9FT03_PEND2",
        "source_organism": {
            "taxId": "1170229",
            "scientificName": "Penicillium digitatum (strain PHI26 / CECT 20796)",
            "fullName": "Penicillium digitatum (strain PHI26 / CECT 20796) (Green mold)"
        },
        "name": "Nuclear transport factor 2",
        "description": [
            "Facilitates protein transport into the nucleus. Could be part of a multicomponent system of cytosolic factors that assemble at the pore complex during nuclear import",
            "Has a role in nuclear-cytoplasmic transport of proteins and mRNAs"
        ],
        "length": 125,
        "sequence": "MADFNAIAQQFVQFYYQTFDGNRAGLAGLYRDQSMLTFETSSVQGVSAITEKLSALPFQKVQHQIATFDAQPSSGDGIVVLVTGALLVDEEQKPMNYTQCFKLQPDGAGSYFVLNDVFRLIYSAQ",
        "proteome": "UP000009882",
        "gene": "PDIG_80500",
        "go_terms": [
            {
                "identifier": "GO:0006913",
                "name": "nucleocytoplasmic transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "afbad8af13c47d1f38e411b81ab56acd5f1b4e87",
        "counters": {
            "domain_architectures": 10709,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10709
        }
    }
}