HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "K9E6Y2",
"id": "K9E6Y2_9LACT",
"source_organism": {
"taxId": "883081",
"scientificName": "Alloiococcus otitis ATCC 51267",
"fullName": "Alloiococcus otitis ATCC 51267"
},
"name": "Ribosomal RNA small subunit methyltransferase A",
"description": [
"Specifically dimethylates two adjacent adenosines (A1518 and A1519) in the loop of a conserved hairpin near the 3'-end of 16S rRNA in the 30S particle. May play a critical role in biogenesis of 30S subunits"
],
"length": 298,
"sequence": "MPHSDIASPSRTIEIQKKYGLQAKKSLGQNFIIDSNILQKMVESAGVDKDTVVIEVGPGIGALTEQVARLAKAVYSFEIDQRLLPVLEDSLAPYKNISIINQDILQVDLGQFCRDQDIDRDRLVVMANLPYYITTPIIMHFLQAPLKLDYLTFMVQKEVGQRIVAGPGTKAYGSLSIAVQYYAQAHILFQVPKTVFRPQPKVDSAVIGLDILDQPSVSVEDEAFFFQVTRASFAQRRKTLWNNLKAHFGKDKEVQAKVQVALGQAGIDPGLRGEALGLADFACLTTALSDQGLKEVGH",
"proteome": "UP000009875",
"gene": "rsmA",
"go_terms": [
{
"identifier": "GO:0000179",
"name": "rRNA (adenine-N6,N6-)-dimethyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000154",
"name": "rRNA modification",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006364",
"name": "rRNA processing",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4b0de80b0859cbff9c9536f8e831ccc961a856e4",
"counters": {
"domain_architectures": 41394,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"pfam": 1,
"profile": 1,
"smart": 1,
"cdd": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 41394
}
}
}