GET /api/protein/UniProt/K7TW38/?format=api
HTTP 200 OK
Allow: GET, HEAD
Cached: true
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Server-Timing: 
Vary: Accept

{
    "metadata": {
        "accession": "K7TW38",
        "id": "K7TW38_MAIZE",
        "source_organism": {
            "taxId": "4577",
            "scientificName": "Zea mays",
            "fullName": "Zea mays (Maize)"
        },
        "name": "Xyloglucan endotransglucosylase/hydrolase",
        "description": [
            "Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues"
        ],
        "length": 290,
        "sequence": "MAALLSMLLVGVALVQLGMHPSAATMDEDIELIWGASHTYFFMDGETESLALSLDDQQGSCFRSKAMFLYGTISMEIKLVEGNSAGVVATAYTISEGPWSYHDEIDLEFLGNETGQPITLHTNIFVNGVGGREQQFYLPFDPTADYHTYTIEWNPKYILIRVDGKAVRAFKNYEEYGVAFPTWQQQRLYGSLWDADEWATQGGRVKTDWSEAPFVAYYRNYTFAWCQPSPGVSWCGAEPRNSSRFDLDQRTLDELRSASDQHKVYDYCTDHKRYDGSEFPKECSLQRQGL",
        "proteome": "UP000007305",
        "gene": "LOC103642033",
        "go_terms": [
            {
                "identifier": "GO:0004553",
                "name": "hydrolase activity, hydrolyzing O-glycosyl compounds",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005975",
                "name": "carbohydrate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016762",
                "name": "xyloglucan:xyloglucosyl transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0010411",
                "name": "xyloglucan metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0042546",
                "name": "cell wall biogenesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0044042",
                "name": "glucan metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005618",
                "name": "cell wall",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0048046",
                "name": "apoplast",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c66f6453f0fcaa3e97e9e976c478e6b228c095ee",
        "counters": {
            "domain_architectures": 15114,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "pfam": 2,
                "ssf": 1,
                "pirsf": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 15114
        }
    }
}