GET /api/protein/UniProt/K7SQM4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "K7SQM4",
        "id": "K7SQM4_9NEIS",
        "source_organism": {
            "taxId": "1194344",
            "scientificName": "Candidatus Snodgrassella sp. T4_34144",
            "fullName": "Candidatus Snodgrassella sp. T4_34144"
        },
        "name": "Crossover junction endodeoxyribonuclease RuvC",
        "description": [
            "The RuvA-RuvB-RuvC complex processes Holliday junction (HJ) DNA during genetic recombination and DNA repair. Endonuclease that resolves HJ intermediates. Cleaves cruciform DNA by making single-stranded nicks across the HJ at symmetrical positions within the homologous arms, yielding a 5'-phosphate and a 3'-hydroxyl group; requires a central core of homology in the junction. The consensus cleavage sequence is 5'-(A/T)TT(C/G)-3'. Cleavage occurs on the 3'-side of the TT dinucleotide at the point of strand exchange. HJ branch migration catalyzed by RuvA-RuvB allows RuvC to scan DNA until it finds its consensus sequence, where it cleaves and resolves the cruciform DNA"
        ],
        "length": 183,
        "sequence": "MQKQPTEQTHIRILGVDPGSRVTGFGVIDVIGSQHIYVASGCIKTTSGAPLAERIRIIVQNLREVITTYQPTQTAVEQVFVNVNPAATLVLGQARGAVLAALTLGELPVFEYTALQVKQAVVGKGKAAKEQVQHMVVQMLSLSGTPQADAADALAVALTHALRNYSLASRIQQGLTIKSGRFR",
        "proteome": null,
        "gene": "ruvC",
        "go_terms": [
            {
                "identifier": "GO:0004520",
                "name": "DNA endonuclease activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006281",
                "name": "DNA repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006310",
                "name": "DNA recombination",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008821",
                "name": "crossover junction DNA endonuclease activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d60f1a9bedb8f81580f51119033923af5affee26",
        "counters": {
            "domain_architectures": 22245,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "cathgene3d": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 22245
        }
    }
}