GET /api/protein/UniProt/K7L4R6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "K7L4R6",
"id": "K7L4R6_SOYBN",
"source_organism": {
"taxId": "3847",
"scientificName": "Glycine max",
"fullName": "Glycine max (Soybean)"
},
"name": "Auxin-induced protein",
"description": [
"Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression"
],
"length": 357,
"sequence": "MLALPCLLFFLYIIFFSSLKCNWPTLHNRAKRKASFNVVVILQYHIFSFSFLICVVKQLKVVLMSEALEEVVPSMKGGCEEEGLNLKATELRLGLPGCESPEREGVFKSVVVSGAKRGFSDAIDGNWNGGGSEKDAAALFSPTSRGAVSVSVSAAKSLTLTATDCTNQPTALGASVLKETVPHSPKPLHENKPQISAPAAKAQVVGWPPIRSFRKNSMASQPQKNDAAADAEAKSGCLYVKVSMEGAPYLRKVDLNSFTTYKDLSLALEKMFSCFTLSQCGSYGVSSRENLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTESCKRLRIMKSSEAIGLAPRAMEKCKSRY",
"proteome": "UP000008827",
"gene": "LOC100795749",
"go_terms": [
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005634",
"name": "nucleus",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6ba825921e6257b43e02eadfb8e6ce84e87ccbf2",
"counters": {
"domain_architectures": 15378,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 15378
}
}
}