General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "K7GGA4",
        "id": "K7GGA4_PELSI",
        "source_organism": {
            "taxId": "13735",
            "scientificName": "Pelodiscus sinensis",
            "fullName": "Pelodiscus sinensis (Chinese softshell turtle)"
        },
        "name": "Suppressor of cytokine signaling 1",
        "description": [
            "Essential negative regulator of type I and type II interferon (IFN) signaling, as well as that of other cytokines, including IL2, IL4, IL6 and leukemia inhibitory factor (LIF). Downregulates cytokine signaling by inhibiting the JAK/STAT signaling pathway. Acts by binding to JAK proteins and to IFNGR1 and inhibiting their kinase activity. In vitro, suppresses Tec protein-tyrosine activity. Regulates IFN-gamma (IFNG)-mediated sensory neuron survival. Probable substrate recognition component of an ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins"
        ],
        "length": 207,
        "sequence": "MVAHSKVAADNAVAADPRCRLDPPARDHSQPRGYHGPARSNTVQAQSDTHFRTFRSQADFSSITRASALLDACGFYWGPLSVSAAHEKLKSEPEGTFLLRDSRQKNCFFAISVKTATGPTSIRINFQAGRFSLDGSKESFDCLFKLLEHYISSSKKVLVTPLRKVRLRPLQELCRKSIVATFGRENLNHIPLNPVLKDYLKSFPFQI",
        "proteome": "UP000007267",
        "gene": "SOCS1",
        "go_terms": [
            {
                "identifier": "GO:0035556",
                "name": "intracellular signal transduction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e16098dee2ddb77b6a79a81058967a7deadb45c6",
        "counters": {
            "domain_architectures": 6301,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 2,
                "cdd": 2,
                "smart": 3,
                "pfam": 2,
                "profile": 2,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6301
        }
    }
}