GET /api/protein/UniProt/K7GG96/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "K7GG96",
        "id": "K7GG96_PELSI",
        "source_organism": {
            "taxId": "13735",
            "scientificName": "Pelodiscus sinensis",
            "fullName": "Pelodiscus sinensis (Chinese softshell turtle)"
        },
        "name": "Nicastrin",
        "description": [
            "Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein). The gamma-secretase complex plays a role in Notch and Wnt signaling cascades and regulation of downstream processes via its role in processing key regulatory proteins, and by regulating cytosolic CTNNB1 levels"
        ],
        "length": 629,
        "sequence": "MNGDTGVIHVVEKDQDLNWVLADGPHPPYMVLLEGELFTRCRELMLRLKGTSRVSGLAVAISKPSPPRGFSPGLQCPNDGFGTGVYDSDYGPQYAHCNWTVWNPLGNGLSYEDFHFPIFLLEDANETQVIKQVQCYQDHNLPRNGSGPEYPLCAMQLFAHMHAVTNTVTCMRRNSIQSTFSLSPGVEVVCDPLSDSNVWSTLKPINASRKMDPADEVVIVATRVQIDSHSFFWNVAPGAESAVSSFVAHLAAAEALHKVPDALTLPRNIMFTFFQGVQETFDYIGSSRMVYDMERNKFPVRLENIHSFLELSQVQVALRNSSALWVHTDPVSGRNESVRPQVQVRALVETLLNSSLGVNVTLQEVSQSQPLPPSSFQRFLRARPIPGAVLADHRAAFQNRYRYYQSVYDTAENILMRYPEGLSPEETLDYVTDTAQVQSLAEVATVVARALYQLAGGTGNTSAIQADPRTVQVSRMLYGFLIKTNNSWFQSIIKQDLKGLLGTGDEPPQHYIAVSYPVNTTQLVQFVLANLTGTVVNFTKEECLNPERAPGADKEVQMYDYTWVQGSREPNSTSRVPFCVQSTVHLTKALSPAFELKEWGSTEYSTWTESRWKDIRARIFLVASKELEV",
        "proteome": "UP000007267",
        "gene": "NCSTN",
        "go_terms": [
            {
                "identifier": "GO:0016485",
                "name": "protein processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f17f9a777791b135feb7411b63bc57824c683eee",
        "counters": {
            "domain_architectures": 2795,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "cdd": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2795
        }
    }
}