GET /api/protein/UniProt/K7GG96/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "K7GG96",
"id": "K7GG96_PELSI",
"source_organism": {
"taxId": "13735",
"scientificName": "Pelodiscus sinensis",
"fullName": "Pelodiscus sinensis (Chinese softshell turtle)"
},
"name": "Nicastrin",
"description": [
"Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein). The gamma-secretase complex plays a role in Notch and Wnt signaling cascades and regulation of downstream processes via its role in processing key regulatory proteins, and by regulating cytosolic CTNNB1 levels"
],
"length": 629,
"sequence": "MNGDTGVIHVVEKDQDLNWVLADGPHPPYMVLLEGELFTRCRELMLRLKGTSRVSGLAVAISKPSPPRGFSPGLQCPNDGFGTGVYDSDYGPQYAHCNWTVWNPLGNGLSYEDFHFPIFLLEDANETQVIKQVQCYQDHNLPRNGSGPEYPLCAMQLFAHMHAVTNTVTCMRRNSIQSTFSLSPGVEVVCDPLSDSNVWSTLKPINASRKMDPADEVVIVATRVQIDSHSFFWNVAPGAESAVSSFVAHLAAAEALHKVPDALTLPRNIMFTFFQGVQETFDYIGSSRMVYDMERNKFPVRLENIHSFLELSQVQVALRNSSALWVHTDPVSGRNESVRPQVQVRALVETLLNSSLGVNVTLQEVSQSQPLPPSSFQRFLRARPIPGAVLADHRAAFQNRYRYYQSVYDTAENILMRYPEGLSPEETLDYVTDTAQVQSLAEVATVVARALYQLAGGTGNTSAIQADPRTVQVSRMLYGFLIKTNNSWFQSIIKQDLKGLLGTGDEPPQHYIAVSYPVNTTQLVQFVLANLTGTVVNFTKEECLNPERAPGADKEVQMYDYTWVQGSREPNSTSRVPFCVQSTVHLTKALSPAFELKEWGSTEYSTWTESRWKDIRARIFLVASKELEV",
"proteome": "UP000007267",
"gene": "NCSTN",
"go_terms": [
{
"identifier": "GO:0016485",
"name": "protein processing",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f17f9a777791b135feb7411b63bc57824c683eee",
"counters": {
"domain_architectures": 2795,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"cdd": 1,
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2795
}
}
}